PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.280970.4
Common NameCsa_5G579040, LOC101214574
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 287aa    MW: 30877 Da    PI: 6.1708
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.280970.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.32.3e-101255445
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     W+ e d+ + +a + ++ +   +W++Ia  ++ g+tl+++k+++ 
   Cucsa.280970.4 12 WSREQDKAFENALATYPEDasdRWEKIAVDVP-GKTLEEVKDHYE 55
                     ********************************.**********96 PP

2Myb_DNA-binding414.4e-13122166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
   Cucsa.280970.4 122 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVSRTPTQVASHAQKY 166
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-5458IPR009057Homeodomain-like
PROSITE profilePS512938.41762IPR017884SANT domain
SMARTSM007175.7E-9860IPR001005SANT/Myb domain
SuperFamilySSF466892.24E-111066IPR009057Homeodomain-like
CDDcd001675.23E-91258No hitNo description
PfamPF002492.5E-71255IPR001005SANT/Myb domain
PROSITE profilePS5129417.948115171IPR017930Myb domain
SuperFamilySSF466893.04E-16117172IPR009057Homeodomain-like
SMARTSM007173.3E-11119169IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-11119165IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-17120169IPR006447Myb domain, plants
CDDcd001671.65E-9122167No hitNo description
PfamPF002497.0E-11122166IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MTVDKESKSS IWSREQDKAF ENALATYPED ASDRWEKIAV DVPGKTLEEV KDHYELLVDD  60
VNQIESGFIP LPSYSFSSDG SPSHASEEGS GNKGDYHGLD NSESRFGSKA PRSDQERRKG  120
TAWTEDEHRL FLLGLDKYGK GDWRSISRNF VVSRTPTQVA SHAQKYFIRL NSMNKDRRRS  180
SIHDITSVDN GDVSAPQGPI TGEANSYGGG GGGSTNKSTK QPPQPPIGSF GVGIYGAPTV  240
GQPVGGPFVS AVGTPIAVNT PPPAHMAYSV SSLATRPPVN MSPITY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1812741173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818960.0LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004147105.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_011655501.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_011655502.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_011655503.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-64DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0A0KV250.0A0A0A0KV25_CUCSA; Uncharacterized protein
STRINGGLYMA07G28310.11e-144(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-100MYB family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]